Cco_S_b precursor (P05547) Protein Card

General Information
Name Cco_S_b precursor
Organism Conus consors
Organism region Indo-Pacific
Organism diet piscivorous
Protein Type Precursor
Notes This sequence was directly retrieved from Terrat 2012.

Classification
Conopeptide class conotoxin
Gene superfamily
Pharmacological family

Sequence
DVQARKTSLKSDFYRALRKYNKR
ECVFDCGTDCSGSCSCDN
APFDWCSCSGPTSKGCKCTCRCRNPTELFKYYSFYHCLDIT
YSKWF
Sequence region
[24-87]mature peptideCco_S_b

References
Terrat,Y., Biass,D., Dutertre,S., Favreau,P., Remm,M., Stöcklin,R., Piquemal,D. and Ducancel,F. (2012) High-resolution picture of a venom gland transcriptome: case study with the marine snail Conus consors. Toxicon 59:34-46

Internal links
Nucleic acids
Structure

External links

Tools