Cco_S_b (P05548) Protein Card

General Information
Name Cco_S_b
Organism Conus consors
Organism region Indo-Pacific
Organism diet piscivorous
Protein Type Wild type
Protein precursor Cco_S_b precursor (5547)
Notes Predicted by ConoServer from the precursor sequence. This peptide display a novel cysteine framework which has not been numbered by the discoveres of the prosequence.

Classification
Conopeptide class conotoxin
Gene superfamily
Pharmacological family

Sequence
ECVFDCGTDCSGSCSCDNAPFDWCSCSGPTSKGCKCTCRCR
NPTELFKYYSFYHCLDITYSKWF
Sequence evidence nucleic acid level
Average Mass 7260.07
Monoisotopic Mass 7254.82
Isoelectric Point 7.11
Extinction Coefficient [280nm] 16960.00

References
Terrat,Y., Biass,D., Dutertre,S., Favreau,P., Remm,M., Stöcklin,R., Piquemal,D. and Ducancel,F. (2012) High-resolution picture of a venom gland transcriptome: case study with the marine snail Conus consors. Toxicon 59:34-46

Internal links
Protein Precursor Cco_S_b precursor (5547)
Nucleic acids
Structure

External links

Tools