Pu6.14 precursor (P05589) Protein Card

General Information
Name Pu6.14 precursor
Alternative name(s) 21902
Organism Conus pulicarius
Organism region Indo-Pacific
Organism diet vermivorous
Protein Type Precursor
Notes Partial on the N-terminus. Required frameshifting to optimize alignment with the reference sequence (see Lluisma 2012).

Classification
Conopeptide class conotoxin
Gene superfamily O1 superfamily
Pharmacological family

Sequence
MKLTCVLIISVLFLMVCQLNTA
DDSRDKQEYRAVRLRDALR
SSRGSR
SCAQLGEPCSNNPCCPGVKCFTLPTPICIWN
Sequence region
[1-22]signal sequence
[48-78]mature peptidePu6.14

References
Lluisma,A.O., Milash,B.A., Moore,B., Olivera,B.M. and Bandyopadhyay,P.K. (2012) Novel venom peptides from the cone snail Conus pulicarius discovered through next-generation sequencing of its venom duct transcriptome. Mar Genomics 5:43-51

Internal links
Nucleic acids
Structure

External links

Tools