Ac4.3a precursor (P00564) Protein Card

General Information
Name Ac4.3a precursor
Organism Conus achatinus
Organism region Indo-Pacific
Organism diet piscivorous
Protein Type Precursor

Classification
Conopeptide class conotoxin
Gene superfamily A superfamily
Pharmacological family

Sequence
SDFRNAAVHER
QKELVVTATTTCCGYNPMTSCPRCMCDSSC
NKKKK
PGRRND
Sequence region
[12-46]mature peptideAc4.3a

References
Yuan,D.D., Han,Y.H., Wang,C.G. and Chi,C.W. (2007) From the identification of gene organization of alpha conotoxins to the cloning of novel toxins Toxicon 49:1135-1149

Internal links
Nucleic acids Conus achatinus alpha conotoxin Ac4.3a gene, partial cds
Structure

External links
UniProtKB/Swiss-Prot P0CAQ2
Ncbi P0CAQ2, ABD33866

Tools