conkunitzin-Pu1 (P05694) Protein Card

General Information
Name conkunitzin-Pu1
Organism Conus pulicarius
Organism region Indo-Pacific
Organism diet vermivorous
Protein Type Wild type
Protein precursor conkunitzin-Pu1 precursor (5693)
Notes Predicted by ConoServer from protein precursor

Classification
Conopeptide class conotoxin
Gene superfamily
Cysteine framework IX
Pharmacological family

Sequence
QGAPAVCTMQKDPGPCKMAITRYYFNVAIFDCTTFSYGGCL
GNGNNFENYDECYETC
Sequence evidence nucleic acid level
Average Mass 6318.01
Monoisotopic Mass 6313.62
Isoelectric Point 6.26
Extinction Coefficient [280nm] 7450.00

References
Lluisma,A.O., Milash,B.A., Moore,B., Olivera,B.M. and Bandyopadhyay,P.K. (2012) Novel venom peptides from the cone snail Conus pulicarius discovered through next-generation sequencing of its venom duct transcriptome. Mar Genomics 5:43-51

Internal links
Protein Precursor conkunitzin-Pu1 precursor (5693)
Nucleic acids
Structure

External links

Tools