G1.6 (P05708) Protein Card

General Information
Name G1.6
Organism Conus geographus (Geography cone)
Organism region Indo-Pacific
Organism diet piscivorous
Protein Type Wild type
Protein precursor G1.6 precursor (5707)
Notes Predicted by ConoServer from protein precursor

Classification
Conopeptide class conotoxin
Gene superfamily A superfamily
Cysteine framework I
Pharmacological family

Sequence
NAAAKAFDLKGCCSHPACSGNYQEYCRESY
Sequence evidence nucleic acid level
Average Mass 3283.58
Monoisotopic Mass 3281.34
Isoelectric Point 7.98
Extinction Coefficient [280nm] 4470.00

References
Hu,H., Bandyopadhyay,P.K., Olivera,B.M. and Yandell,M. (2012) Elucidation of the molecular envenomation strategy of the cone snail Conus geographus through transcriptome sequencing of its venom duct. BMC Genomics 13:284

Internal links
Protein Precursor G1.6 precursor (5707)
Nucleic acids
Structure

External links

Tools