G6.3 (P05729) Protein Card

General Information
Name G6.3
Organism Conus geographus (Geography cone)
Organism region Indo-Pacific
Organism diet piscivorous
Protein Type Wild type
Protein precursor G6.3 precursor (5728)
Notes Predicted by ConoServer from protein precursor

Classification
Conopeptide class conotoxin
Gene superfamily O1 superfamily
Cysteine framework VI/VII
Pharmacological family

Sequence
ALRSTKVSKSPPCLVAGSSCRGTTRVCCGFCSHYGYKCRDR
PTS
Sequence evidence nucleic acid level
Average Mass 4721.41
Monoisotopic Mass 4718.19
Isoelectric Point 12.70
Extinction Coefficient [280nm] 2980.00

References
Hu,H., Bandyopadhyay,P.K., Olivera,B.M. and Yandell,M. (2012) Elucidation of the molecular envenomation strategy of the cone snail Conus geographus through transcriptome sequencing of its venom duct. BMC Genomics 13:284

Internal links
Protein Precursor G6.3 precursor (5728)
Nucleic acids
Structure

External links

Tools