GVIIJ precursor (P05732) Protein Card

General Information
Name GVIIJ precursor
Alternative name(s) G19,G6.4
Organism Conus geographus (Geography cone)
Organism region Indo-Pacific
Organism diet piscivorous
Protein Type Precursor
Notes This precursor was initially discovered at the RNA level and names G6.4. The mature peptide was discovered in another study at the protein level and was named GVIIJ.

Classification
Conopeptide class conotoxin
Gene superfamily O1 superfamily
Pharmacological family

Sequence
MKLTCVVIVAALLLTACQLITA
LDCGGTQKHRALRSTIKLS
LLRQHR
GWCGDPGATCGKLRLYCCSGFCDCYTKTCKDKSSA
Sequence region
[1-22]signal sequence
[48-82]mature peptideGVIIJ

References
Hu,H., Bandyopadhyay,P.K., Olivera,B.M. and Yandell,M. (2012) Elucidation of the molecular envenomation strategy of the cone snail Conus geographus through transcriptome sequencing of its venom duct. BMC Genomics 13:284

Internal links
Nucleic acids
Structure

External links

Tools