G6.7 precursor (P05737) Protein Card

General Information
Name G6.7 precursor
Alternative name(s) G22
Organism Conus geographus (Geography cone)
Organism region Indo-Pacific
Organism diet piscivorous
Protein Type Precursor

Classification
Conopeptide class conotoxin
Gene superfamily O1 superfamily
Pharmacological family

Sequence
MNLTCVLIINVLFLTACQVITA
DDSRDKQIYRAVRSRDGMR
NFRSSR
PCANLGRACDTVPCCLGVRCFESRTPTCLLKQRGV
Sequence region
[1-22]signal sequence
[48-82]mature peptideG6.7

References
Hu,H., Bandyopadhyay,P.K., Olivera,B.M. and Yandell,M. (2012) Elucidation of the molecular envenomation strategy of the cone snail Conus geographus through transcriptome sequencing of its venom duct. BMC Genomics 13:284

Internal links
Nucleic acids Conus geographus mRNA for G094_VD_Superfamily_O1-variant1_precursor_conopeptide, complete cds.
Structure

External links

Tools