G6.8 (P05746) Protein Card

General Information
Name G6.8
Organism Conus geographus (Geography cone)
Organism region Indo-Pacific
Organism diet piscivorous
Protein Type Wild type
Protein precursor G6.8 precursor (5745)
Notes Predicted by ConoServer from protein precursor

Classification
Conopeptide class conotoxin
Gene superfamily O2 superfamily
Cysteine framework VI/VII
Pharmacological family

Sequence
GVWSECSDWLAGCSSPSECCSEKCDTFCRLW
Sequence evidence nucleic acid level
Average Mass 3469.81
Monoisotopic Mass 3467.31
Isoelectric Point 4.33
Extinction Coefficient [280nm] 16500.00

References
Hu,H., Bandyopadhyay,P.K., Olivera,B.M. and Yandell,M. (2012) Elucidation of the molecular envenomation strategy of the cone snail Conus geographus through transcriptome sequencing of its venom duct. BMC Genomics 13:284

Internal links
Protein Precursor G6.8 precursor (5745)
Nucleic acids
Structure

External links

Tools