conotoxin-GS precursor (P05752) Protein Card

General Information
Name conotoxin-GS precursor
Alternative name(s) G30
Organism Conus geographus (Geography cone)
Organism region Indo-Pacific
Organism diet piscivorous
Protein Type Precursor

Classification
Conopeptide class conotoxin
Gene superfamily O1 superfamily
Pharmacological family

Sequence
MKLTCLLIIAVLFLTACQLITA
NDPRDNQEYRAVRMKDALN
FKDSR
ACSGRGSRCPPQCCMGLRCGRGNPQKCIGAHEDV
Sequence region
[1-22]signal sequence
[47-80]mature peptideconotoxin-GS

References
Hu,H., Bandyopadhyay,P.K., Olivera,B.M. and Yandell,M. (2012) Elucidation of the molecular envenomation strategy of the cone snail Conus geographus through transcriptome sequencing of its venom duct. BMC Genomics 13:284

Internal links
Nucleic acids Conus geographus mRNA for G082_VD_Superfamily_O1_precursor_conopept ide, complete cds.
Structure

External links

Tools