G33 precursor (P05755) Protein Card

General Information
Name G33 precursor
Alternative name(s) G33
Organism Conus geographus (Geography cone)
Organism region Indo-Pacific
Organism diet piscivorous
Protein Type Precursor

Classification
Conopeptide class conotoxin
Gene superfamily O1 superfamily
Pharmacological family

Sequence
MKLTCALIVAVLFLMACQLITA
ENSRGSREYSAVRSSDKIR
DSDDRQLTKE
CTQDFDPCMPVCHECCTRSHFVVCRRPICL
R
RIF
Sequence region
[1-22]signal sequence
[52-81]mature peptideG33

References
Hu,H., Bandyopadhyay,P.K., Olivera,B.M. and Yandell,M. (2012) Elucidation of the molecular envenomation strategy of the cone snail Conus geographus through transcriptome sequencing of its venom duct. BMC Genomics 13:284

Internal links
Nucleic acids
Structure

External links

Tools