G33 (P05756) Protein Card

General Information
Name G33
Organism Conus geographus (Geography cone)
Organism region Indo-Pacific
Organism diet piscivorous
Protein Type Wild type
Protein precursor G33 precursor (5755)
Notes Predicted by ConoServer from protein precursor. The cysteine framework of this peptide is unclear as it has an odd number (7) of cysteines in its primary sequence. It possibly displays a cysteine framework related to the VI/VII.

Classification
Conopeptide class conotoxin
Gene superfamily O1 superfamily
Cysteine framework VI/VII
Pharmacological family

Sequence
CTQDFDPCMPVCHECCTRSHFVVCRRPICL
Sequence evidence nucleic acid level
Average Mass 3494.10
Monoisotopic Mass 3491.44
Isoelectric Point 7.88
Extinction Coefficient [280nm] 125.00

References
Hu,H., Bandyopadhyay,P.K., Olivera,B.M. and Yandell,M. (2012) Elucidation of the molecular envenomation strategy of the cone snail Conus geographus through transcriptome sequencing of its venom duct. BMC Genomics 13:284

Internal links
Protein Precursor G33 precursor (5755)
Nucleic acids
Structure

External links

Tools