G14.3 precursor (P05787) Protein Card

General Information
Name G14.3 precursor
Alternative name(s) G51
Organism Conus geographus (Geography cone)
Organism region Indo-Pacific
Organism diet piscivorous
Protein Type Precursor

Classification
Conopeptide class conotoxin
Gene superfamily J superfamily
Pharmacological family

Sequence
MPSVQSVTRCCLLWLMLSVQLVTP
GSRGTAQLPRDDLDETT
R
EEICRYMCSRKIDYHMCTCPSKRDAISSRIV
RRKRSMAV
Sequence region
[1-24]signal sequence
[43-73]mature peptideG14.3

References
Hu,H., Bandyopadhyay,P.K., Olivera,B.M. and Yandell,M. (2012) Elucidation of the molecular envenomation strategy of the cone snail Conus geographus through transcriptome sequencing of its venom duct. BMC Genomics 13:284

Internal links
Nucleic acids
Structure

External links

Tools