con-ikot-ikot-G1 (P05794) Protein Card

General Information
Name con-ikot-ikot-G1
Organism Conus geographus (Geography cone)
Organism region Indo-Pacific
Organism diet piscivorous
Protein Type Wild type
Protein precursor con-ikot-ikot-G1 precursor (5793)
Notes Predicted by ConoServer from protein precursor

Classification
Conopeptide class con-ikot-ikot
Gene superfamily
Pharmacological family

Sequence
SPPPHNDCCKMKECCAQTTELCLKEFPNEEHIYTSTCYQRA
SHACGQFNEIVGCCYGYRQCMLQNVQNLGLNWANQQCKEWN
CLNPCE
Sequence evidence nucleic acid level
Average Mass 10132.36
Monoisotopic Mass 10125.24
Isoelectric Point 6.71
Extinction Coefficient [280nm] 17085.00

References
Hu,H., Bandyopadhyay,P.K., Olivera,B.M. and Yandell,M. (2012) Elucidation of the molecular envenomation strategy of the cone snail Conus geographus through transcriptome sequencing of its venom duct. BMC Genomics 13:284

Internal links
Protein Precursor con-ikot-ikot-G1 precursor (5793)
Nucleic acids
Structure

External links

Tools