Con-ikot-ikot-G5 (P05802) Protein Card

General Information
Name Con-ikot-ikot-G5
Organism Conus geographus (Geography cone)
Organism region Indo-Pacific
Organism diet piscivorous
Protein Type Wild type
Protein precursor Con-ikot-ikot-G5 precursor (5801)
Notes Predicted by ConoServer from protein precursor

Classification
Conopeptide class con-ikot-ikot
Gene superfamily
Pharmacological family

Sequence
DEPLDCCEMKKCCVRSMYECLQDHRGNEYDMATECYQKAGD
ICGSYNEIVGCCQGYEICILKNVPHTGLQRAHDLCESTDCY
NPCQ
Sequence evidence nucleic acid level
Average Mass 9774.90
Monoisotopic Mass 9767.99
Isoelectric Point 5.85
Extinction Coefficient [280nm] 9065.00

References
Hu,H., Bandyopadhyay,P.K., Olivera,B.M. and Yandell,M. (2012) Elucidation of the molecular envenomation strategy of the cone snail Conus geographus through transcriptome sequencing of its venom duct. BMC Genomics 13:284

Internal links
Protein Precursor Con-ikot-ikot-G5 precursor (5801)
Nucleic acids
Structure

External links

Tools