conophysin-G precursor (P05809) Protein Card

General Information
Name conophysin-G precursor
Alternative name(s) G63
Organism Conus geographus (Geography cone)
Organism region Indo-Pacific
Organism diet piscivorous
Protein Type Precursor

Classification
Conopeptide class unclassified
Gene superfamily
Pharmacological family

Sequence
MTRSAMQMGRLTLVLCLLLLLLLTTQA
CFITNCPVGGKRHV
EA
THPCMSCSFGQCVGPQICCGLGGCEMGTAEANKCIEEDD
DQTPCQVLGDHCDLNNLDIEGHCVADGICCVDDTCAIHSSC
Sequence region
[1-27]signal sequence
[44-123]mature peptideconophysin-G

References
Hu,H., Bandyopadhyay,P.K., Olivera,B.M. and Yandell,M. (2012) Elucidation of the molecular envenomation strategy of the cone snail Conus geographus through transcriptome sequencing of its venom duct. BMC Genomics 13:284

Internal links
Nucleic acids
Structure

External links

Tools