conophysin-G (P05811) Protein Card

General Information
Name conophysin-G
Organism Conus geographus (Geography cone)
Organism region Indo-Pacific
Organism diet piscivorous
Protein Type Wild type
Protein precursor conophysin-G precursor (5809)

Classification
Conopeptide class unclassified
Gene superfamily
Pharmacological family

Sequence
THPCMSCSFGQCVGPQICCGLGGCEMGTAEANKCIEEDDDQ
TPCQVLGDHCDLNNLDIEGHCVADGICCVDDTCAIHSSC
Sequence evidence nucleic acid level
Average Mass 8327.15
Monoisotopic Mass 8321.18
Isoelectric Point 4.24
Extinction Coefficient [280nm] NA

References
Hu,H., Bandyopadhyay,P.K., Olivera,B.M. and Yandell,M. (2012) Elucidation of the molecular envenomation strategy of the cone snail Conus geographus through transcriptome sequencing of its venom duct. BMC Genomics 13:284

Internal links
Protein Precursor conophysin-G precursor (5809)
Nucleic acids
Structure

External links

Tools