Tx6.6 (P05837) Protein Card

General Information
Name Tx6.6 (named by ConoServer)
Organism Conus textile (Cloth-of-gold cone)
Organism region Indo-Pacific
Organism diet molluscivorous
Protein Type Wild type
Protein precursor Tx6.6 precursor (2007)

Classification
Conopeptide class conotoxin
Gene superfamily O1 superfamily
Cysteine framework VI/VII
Pharmacological family

Sequence
DCQEKWDYCPVPFLGSRYCCDGFICPSFFCA(nh2)
Modified residues
positionsymbolname
32nh2C-term amidation
Sequence evidence protein level
Average Mass 3594.09
Monoisotopic Mass 3591.43
Isoelectric Point 5.62
Extinction Coefficient [280nm] 8480.00

References
Bhatia,S., Kil,Y.J., Ueberheide,B., Chait,B.T., Tayo,L., Cruz,L., Lu,B., Yates,J.R. 3rd. and Bern,M. (2012) Constrained de novo sequencing of conotoxins. J. Proteome Res. 11:4191-4200

Internal links
Protein Precursor Tx6.6 precursor (2007)
Nucleic acids
Structure

External links

Tools