MfVIA (P05840) Protein Card

General Information
Name MfVIA
Organism Conus magnificus
Protein Type Wild type

Classification
Conopeptide class conotoxin
Gene superfamily
Cysteine framework VI/VII
Pharmacological family mu conotoxin

Sequence
RDCQEKWEYCIVPILGFVYCCPGLICGPFVCV
Sequence evidence protein level
Average Mass 3648.36
Monoisotopic Mass 3645.64
Isoelectric Point 6.43
Extinction Coefficient [280nm] 8480.00

Activity

IC50: Voltage-Gated Sodium Channels

TargetOrganismIC50AgonistRef
Nav1.1H. sapiens(FLIPR)3.3uM+/-0.1veratridineVetter,I. et al. (2012)
Nav1.2R. norvegicus(FLIPR)6.3uM+/-0.7veratridineVetter,I. et al. (2012)
5.1uM+/-0.5Vetter,I. et al. (2012)
Nav1.3H. sapiens(FLIPR)2.2uM+/-0.3veratridineVetter,I. et al. (2012)
Nav1.4H. sapiens81nM+/-16Vetter,I. et al. (2012)
Nav1.5H. sapiens431nM+/-146Vetter,I. et al. (2012)
(FLIPR)3.9uM+/-0.9veratridineVetter,I. et al. (2012)
Nav1.6H. sapiens1.2uM+/-0.2Vetter,I. et al. (2012)
(FLIPR)4.7uM+/-0.5veratridineVetter,I. et al. (2012)
Nav1.7H. sapiens(FLIPR)5.5uM+/-0.9veratridineVetter,I. et al. (2012)
2.3uM+/-0.3Vetter,I. et al. (2012)
Nav1.8H. sapiens(FLIPR)529nM+/-50100uM deltamethrinVetter,I. et al. (2012)
157.6nM+/-63.8Vetter,I. et al. (2012)

Synthetic variants
MfVIA [E5A]VCVFPGCILGPCCYVFGLIPVICYEWKAQCDR
MfVIA [E5K,E8K]VCVFPGCILGPCCYVFGLIPVICYKWKKQCDR
MfVIA [E8A]VCVFPGCILGPCCYVFGLIPVICYAWKEQCDR
MfVIA [F17A]VCVFPGCILGPCCYVAGLIPVICYEWKEQCDR
MfVIA [F29A]VCVAPGCILGPCCYVFGLIPVICYEWKEQCDR
MfVIA [I14A]VCVFPGCILGPCCYVFGLAPVICYEWKEQCDR
MfVIA [K6A]VCVFPGCILGPCCYVFGLIPVICYEWAEQCDR
MfVIA [L15A]VCVFPGCILGPCCYVFGAIPVICYEWKEQCDR
MfVIA [V18A]VCVFPGCILGPCCYAFGLIPVICYEWKEQCDR
MfVIA [W7A]VCVFPGCILGPCCYVFGLIPVICYEAKEQCDR
MfVIA [Y19A]VCVFPGCILGPCCYAFGLIPVICYEWKEQCDR
MfVIA [Y19F]VCVFPGCILGPCCFVFGLIPVICYEWKEQCDR
MfVIA [Y19W]VCVFPGCILGPCCWVFGLIPVICYEWKEQCDR

References
Vetter,I., Dekan,Z., Knapp,O., Adams,D.J., Alewood,P.F. and Lewis,R.J. (2012) Isolation, characterization and total regioselective synthesis of the novel μO-conotoxin MfVIA from Conus magnificus that targets voltage-gated sodium channels. Biochem. Pharmacol. 84:540-548

Internal links
Nucleic acids
Structure NMR solution structure of muO-conotoxin MfVIA

External links

Tools