Pc6b (P05860) Protein Card

General Information
Name Pc6b
Organism Conus pictus
Organism region South Africa
Protein Type Wild type

Classification
Conopeptide class conotoxin
Gene superfamily
Cysteine framework VI/VII
Pharmacological family

Sequence
TCLEIGEFCGKPMMVGSLCCSPGWCFFICVG
Sequence evidence protein level
Average Mass 3312.98
Monoisotopic Mass 3310.36
Isoelectric Point 4.51
Extinction Coefficient [280nm] 5500.00

References
Peigneur,S., Van Der Haegen,A., Möller,C., Waelkens,E., Diego-García,E., Marí,F., Naudé,R. and Tytgat,J. (2013) Unraveling the peptidome of the South African cone snails Conus pictus and Conus natalis. Peptides 41:8-16

Internal links
Nucleic acids
Structure

External links
UniProtKB/Swiss-Prot P0DMA2

Tools