Br7.5 precursor (P05879) Protein Card

General Information
Name Br7.5 precursor
Organism Conus brunneus
Organism region Eastern Pacific
Organism diet vermivorous
Protein Type Precursor

Classification
Conopeptide class conotoxin
Gene superfamily O2 superfamily
Pharmacological family

Sequence
MKLTILLLVAAVLMSTQA
LIQGGRENPQKAKMNFLKARRLP
GSR
QIAEKCGGWICEDTWDCCYYAECKDGYCVEI
Sequence region
[1-18]signal sequence
[45-75]mature peptideBr7.5

References

Internal links
Nucleic acids Br7.5 precursor, mRNA, complete cds.
Structure

External links
Ncbi AFI41812

Tools