Br7.6 precursor (P05881) Protein Card

General Information
Name Br7.6 precursor (named by ConoServer)
Alternative name(s) Br7.7
Organism Conus brunneus
Organism region Eastern Pacific
Organism diet vermivorous
Protein Type Precursor

Classification
Conopeptide class conotoxin
Gene superfamily O1 superfamily
Pharmacological family

Sequence
MKLTCVLIVAMLFLTVCQL
IAPDDSRDKQEYPAERWRTKMQ
NSKR
TTSTRKCKGPLVFCLENHECCSKFCDFSDIPLRYCST
P
Sequence region
[1-19]signal sequence
[46-83]mature peptideBr7.6

References

Internal links
Nucleic acids Br7.7 precursor, mRNA, complete cds.
Structure

External links
Ncbi AFI41814

Tools