Mr14.3 precursor (P05888) Protein Card

General Information
Name Mr14.3 precursor
Organism Conus marmoreus
Organism region Indo-Pacific
Organism diet molluscivorous
Protein Type Precursor

Classification
Conopeptide class conotoxin
Gene superfamily J superfamily
Pharmacological family

Sequence
MPSVRSVTCCCLLWMMFSVQLVNP
GSPGTAQLFRHRTAR
VL
AELILEIICLEMCEEGVGEEPFCHCTEKRDAVFSRI
RRRKR
STAV
Sequence region
[1-24]signal sequence
[40-77]mature peptideMr14.3

References

Internal links
Nucleic acids Mr14.3 mRNA, complete cds.
Structure

External links
Ncbi AGE10494

Tools