Mr14.5 precursor (P05889) Protein Card

General Information
Name Mr14.5 precursor
Organism Conus marmoreus
Organism region Indo-Pacific
Organism diet molluscivorous
Protein Type Precursor

Classification
Conopeptide class conotoxin
Gene superfamily J superfamily
Pharmacological family

Sequence
MPSVRSVTCCCLLWMMFSVQLVNP
GSPGTAQLSRHRTAR
VP
AEPILEIICPEMCDKGVGEEPFCHCTEKRDAVSSRI
RRRKR
STAV
Sequence region
[1-24]signal sequence
[40-77]mature peptideMr14.5

References

Internal links
Nucleic acids Mr14.5 mRNA, complete cds.
Structure

External links
Ncbi AGE10495

Tools