Im14.1 precursor (P05890) Protein Card

General Information
Name Im14.1 precursor
Organism Conus imperialis
Organism region Indo-Pacific
Organism diet vermivorous
Protein Type Precursor

Classification
Conopeptide class conotoxin
Gene superfamily J superfamily
Pharmacological family

Sequence
MPSVRSVTCCCLLWMMFSVQLVTP
GSPGTAQLPRDRTAR
AP
AELILETICPHMCGIGIGEPFCNCRNKRDVVSSRII
RRKRS
MAV
Sequence region
[1-24]signal sequence
[40-77]mature peptideIm14.1

References

Internal links
Nucleic acids Im14.1 mRNA, complete cds
Structure

External links
Ncbi AGE10496

Tools