Bt14.3 precursor (P05892) Protein Card

General Information
Name Bt14.3 precursor
Organism Conus betulinus
Organism region Indo-Pacific
Organism diet vermivorous
Protein Type Precursor

Classification
Conopeptide class conotoxin
Gene superfamily J superfamily
Pharmacological family

Sequence
MPSVRSVTCCCLLWMMFSVQLVTP
GSPGTAQLPRDRTAR
AP
AELILETICPHMCGTGIGEPFCNCRNKRDVVSSRII
RRKRS
MAV
Sequence region
[1-24]signal sequence
[40-77]mature peptideBt14.3

References

Internal links
Nucleic acids Bt14.3 mRNA, complete cds.
Structure

External links
Ncbi AGE10498

Tools