Vi14.1 precursor (P05893) Protein Card

General Information
Name Vi14.1 precursor
Organism Conus virgo
Organism region Indo-Pacific
Organism diet vermivorous
Protein Type Precursor

Classification
Conopeptide class conotoxin
Gene superfamily J superfamily
Pharmacological family

Sequence
MPSVRSVTCCCLLWMMFSLTLVTP
GSPGPAQLPGHRAAR
VP
AEQMMEELCPDMCNRGEGEIICTCVLRRHVVFPSIR
GRKRS
MAV
Sequence region
[1-24]signal sequence
[40-77]mature peptideVi14.1

References

Internal links
Nucleic acids Vi14.1 mRNA, complete cds.
Structure

External links
Ncbi AGE10499

Tools