Di14.1 precursor (P05896) Protein Card

General Information
Name Di14.1 precursor
Organism Conus distans
Organism region Indo-Pacific
Organism diet vermivorous
Protein Type Precursor

Classification
Conopeptide class conotoxin
Gene superfamily J superfamily
Pharmacological family

Sequence
MPSVRSVTCCCLLWMMF
FHAFATGMGGCIWTILLFHAYGAH
FPGRIVSARLLSLCWVYRCLLLPVLCLWLFASSASESCSFV
TLYWELVTRCR
Sequence region
[1-17]signal sequence

References

Internal links
Nucleic acids Di14.1 mRNA, complete cds.
Structure

External links
Ncbi AGE10502

Tools