Mr6.11 precursor (P05902) Protein Card

General Information
Name Mr6.11 precursor
Organism Conus marmoreus
Organism region Indo-Pacific
Organism diet molluscivorous
Protein Type Precursor

Classification
Conopeptide class conotoxin
Gene superfamily
Pharmacological family

Sequence
MSKLGVVLFLTACQLLTA
DNSRDKQEYPTMRFRDQMRNAKG
PKWIR
SCAQSGLSCDTRPCCDDKPCVPNGRQSMCG
G
Sequence region
[1-18]signal sequence
[47-76]mature peptideMr6.11

References

Internal links
Nucleic acids Mr6.11 mRNA, complete cds.
Structure

External links
Ncbi AGE10508

Tools