Di6.12 precursor (P05922) Protein Card

General Information
Name Di6.12 precursor
Organism Conus distans
Organism region Indo-Pacific
Organism diet vermivorous
Protein Type Precursor

Classification
Conopeptide class conotoxin
Gene superfamily O3 superfamily
Pharmacological family

Sequence
MSGLGFMVLTFLLLVSMATS
KQDGRVRRRMLHTR
LVEGACT
SPSNCPTGQECCPDKLDEPEGSCANSCPFY
Sequence region
[1-20]signal sequence
[35-71]mature peptideDi6.12

References

Internal links
Nucleic acids Di6.12 mRNA, complete cds.
Structure

External links
Ncbi AGE10529

Tools