Im6.1 precursor (P05926) Protein Card

General Information
Name Im6.1 precursor
Organism Conus imperialis
Organism region Indo-Pacific
Organism diet vermivorous
Protein Type Precursor

Classification
Conopeptide class conotoxin
Gene superfamily O1 superfamily
Pharmacological family

Sequence
MKLTCMVIVAVLLLTACQLNTADG
SRDKQEDRLVKLFNKRW
NSPDSRLTRK
CQPNGYYCDFEFTPKCCLKCDYNRKYCQPY
Sequence region
[1-24]signal sequence
[52-81]mature peptideIm6.1

References

Internal links
Nucleic acids Im6.1 mRNA, complete cds.
Structure

External links
Ncbi AGG19135

Tools