Im6.2 precursor (P05932) Protein Card

General Information
Name Im6.2 precursor
Organism Conus imperialis
Organism region Indo-Pacific
Organism diet vermivorous
Protein Type Precursor

Classification
Conopeptide class conotoxin
Gene superfamily O2 superfamily
Pharmacological family

Sequence
MEKLTILLLVAALLVLTQA
RTERRRVKSR
KTSSTYDDEMAT
FCWSYWNEFQYSYPYTYVQPCLTLGKACTTNSDCCSKYCNT
KMCKINWE
G
Sequence region
[1-19]signal sequence
[30-90]mature peptideIm6.2

References

Internal links
Nucleic acids Im6.2 mRNA, complete cds.
Structure

External links
Ncbi AGG19141

Tools