Im16.1 precursor (P05936) Protein Card

General Information
Name Im16.1 precursor (named by ConoServer)
Alternative name(s) Im6.6
Organism Conus imperialis
Organism region Indo-Pacific
Organism diet vermivorous
Protein Type Precursor

Classification
Conopeptide class conotoxin
Gene superfamily O2 superfamily
Cysteine framework XVI
Pharmacological family

Sequence
MEKLTILLLVTAVLMSTQA
LMQSGIEKRQRAKIKFFSKRKT
TVER
WWEGECYDWLRQCSSPAQCCSGNCGAHSKA
G
Sequence region
[1-19]signal sequence
[46-75]mature peptideIm16.1

References

Internal links
Nucleic acids Im16.1 (Im6.6) mRNA, complete cds.
Structure

External links
Ncbi AGG19145

Tools