Br7.8 (P05945) Protein Card

General Information
Name Br7.8
Organism Conus brunneus
Organism region Eastern Pacific
Organism diet vermivorous
Protein Type Wild type
Protein precursor Br7.8 precursor (5882)
Notes Predicted by ConoServer from protein precursor

Classification
Conopeptide class conotoxin
Gene superfamily O1 superfamily
Cysteine framework VI/VII
Pharmacological family

Sequence
TTSTRKCKGPLVFCLENHECCSKFCDFIDIPLRYCSTP
Sequence evidence nucleic acid level
Average Mass 4351.04
Monoisotopic Mass 4347.97
Isoelectric Point 10.39
Extinction Coefficient [280nm] 1490.00

References

Internal links
Protein Precursor Br7.8 precursor (5882)
Nucleic acids
Structure

External links

Tools