Mr14.5 (P05953) Protein Card

General Information
Name Mr14.5
Organism Conus marmoreus
Organism region Indo-Pacific
Organism diet molluscivorous
Protein Type Wild type
Protein precursor Mr14.5 precursor (5889)
Notes Predicted by ConoServer from protein precursor

Classification
Conopeptide class conotoxin
Gene superfamily J superfamily
Cysteine framework XIV
Pharmacological family

Sequence
VPAEPILEIICPEMCDKGVGEEPFCHCTEKRDAVSSRI
Sequence evidence nucleic acid level
Average Mass 4198.82
Monoisotopic Mass 4195.95
Isoelectric Point 4.72
Extinction Coefficient [280nm] -1.00

References

Internal links
Protein Precursor Mr14.5 precursor (5889)
Nucleic acids
Structure

External links

Tools