MrVIB precursor (P00597) Protein Card

General Information
Name MrVIB precursor
Alternative name(s) Mr051
Organism Conus marmoreus
Organism region Indo-Pacific
Organism diet molluscivorous
Protein Type Precursor

Classification
Conopeptide class conotoxin
Gene superfamily O1 superfamily
Pharmacological family

Sequence
MKLTCMMIVAVLFLTAWTLVMA
DDSNNGLANHFLKSRDEME
DPEASKLEKR
ACSKKWEYCIVPILGFVYCCPGLICGPFVCV
Sequence region
[1-22]signal sequence
[52-82]mature peptideMrVIB

References
McIntosh,J.M., Hasson,A., Spira,M.E., Gray,W.R., Li,W., Marsh,M., Hillyard,D.R. and Olivera,B.M. (1995) A new family of conotoxins that blocks voltage-gated sodium channels J. Biol. Chem. 270:16796-16802
Daly,N.L., Ekberg,J.A., Thomas,L., Adams,D.J., Lewis,R.J. and Craik,D.J. (2004) Structures of muO-conotoxins from Conus marmoreus. I nhibitors of tetrodotoxin (TTX)-sensitive and TTX-resistant sodium channels in mammalian sensory neurons J. Biol. Chem. 279:25774-25782
Fainzilber,M., van der Schors,R., Lodder,J.C., Li,K.W., Geraerts,W.P. and Kits,K.S. (1995) New sodium channel-blocking conotoxins also affect calcium currents in Lymnaea neurons Biochemistry 34:5364-5371
Bulaj,G., Zhang,M.M., Green,B.R., Fiedler,B., Layer,R.T., Wei,S., Nielsen,J.S., Low,S.J., Klein,B.D., Wagstaff,J.D., Chicoine,L., Harty,T.P., Terlau,H., Yoshikami,D. and Olivera,B.M. (2006) Synthetic muO-conotoxin MrVIB blocks TTX-resistant sodium channel NaV1.8 and has a long-lasting analgesic activity Biochemistry 45:7404-7414
Zorn,S., Leipold,E., Hansel,A., Bulaj,G., Olivera,B.M., Terlau,H. and Heinemann,S.H. (2006) The muO-conotoxin MrVIA inhibits voltage-gated sodium channels by associating with domain-3 FEBS Lett. 580:1360-1364
Dutertre,S., Jin,A.H., Kaas,Q., Jones,A., Alewood,P.F. and Lewis,R.J. (2013) Deep venomics reveals the mechanism for expanded peptide diversity in cone snail venom. Mol. Cell Proteomics 12:312-329

Internal links
Nucleic acids Sequence 5 from patent US 5990295
mu-O conotoxin MrVIB precursor=voltage-gated sodium channel blocker [Conus marmoreus=marble cones, venom ducts, mRNA Partial, 255 nt]
Sequence 5 from patent US 5719264
Sequence 5 from patent US 5739276
Structure

External links
UniProtKB/Swiss-Prot Q26443
Ncbi Q26443, AAB34916

Tools