Eu6.2 (P05973) Protein Card

General Information
Name Eu6.2
Organism Conus eburneus
Organism diet generalist
Protein Type Wild type
Protein precursor Eu6.2 precursor (5924)
Notes Predicted by ConoServer from protein precursor

Classification
Conopeptide class conotoxin
Gene superfamily O1 superfamily
Cysteine framework VI/VII
Pharmacological family

Sequence
DAMQKSKGSGSCADLSEACDILLCCPGLKCNEDFIPICL
Sequence evidence nucleic acid level
Average Mass 4086.71
Monoisotopic Mass 4083.79
Isoelectric Point 4.50
Extinction Coefficient [280nm] -1.00

References

Internal links
Protein Precursor Eu6.2 precursor (5924)
Nucleic acids
Structure

External links

Tools