Im6.1 (P05991) Protein Card

General Information
Name Im6.1
Organism Conus imperialis
Organism region Indo-Pacific
Organism diet vermivorous
Protein Type Wild type
Protein precursor Im6.1 precursor (5926)
Notes Predicted by ConoServer from protein precursor

Classification
Conopeptide class conotoxin
Gene superfamily O1 superfamily
Cysteine framework VI/VII
Pharmacological family

Sequence
CQPNGYYCDFEFTPKCCLKCDYNRKYCQPY
Sequence evidence nucleic acid level
Average Mass 3688.16
Monoisotopic Mass 3685.47
Isoelectric Point 10.53
Extinction Coefficient [280nm] 7450.00

References

Internal links
Protein Precursor Im6.1 precursor (5926)
Nucleic acids
Structure

External links

Tools