Im6.2 (P05992) Protein Card

General Information
Name Im6.2
Organism Conus imperialis
Organism region Indo-Pacific
Organism diet vermivorous
Protein Type Wild type
Protein precursor Im6.2 precursor (5932)
Im6.2 precursor (8748)

Classification
Conopeptide class conotoxin
Gene superfamily O2 superfamily
Cysteine framework VI/VII
Pharmacological family

Sequence
KTSSTYDDEMATFCWSYWNEFQYSYPYTYVQPCLTLGKACT
TNSDCCSKYCNTKMCKINWE
Sequence evidence protein level
Average Mass 7241.06
Monoisotopic Mass 7235.99
Isoelectric Point 7.16
Extinction Coefficient [280nm] 27055.00

References
Jin, A.H., Dutertre, S., Dutt, M., Lavergne, V., Jones, A., Lewis, R.J. and Alewood, P.F. (2019) Transcriptomic-Proteomic Correlation in the Predation-Evoked Venom of the Cone Snail, Conus imperialis Marine drugs 17:177

Internal links
Protein Precursor Im6.2 precursor (5932)
Im6.2 precursor (8748)
Nucleic acids
Structure

External links

Tools