Im16.1 (P05996) Protein Card

General Information
Name Im16.1 (named by ConoServer)
Organism Conus imperialis
Organism region Indo-Pacific
Organism diet vermivorous
Protein Type Wild type
Protein precursor Im16.1 precursor (5936)
Notes Predicted by ConoServer from protein precursor

Classification
Conopeptide class conotoxin
Gene superfamily O2 superfamily
Cysteine framework XVI
Pharmacological family

Sequence
WWEGECYDWLRQCSSPAQCCSGNCGAHSKA
Sequence evidence nucleic acid level
Average Mass 3359.65
Monoisotopic Mass 3357.29
Isoelectric Point 6.62
Extinction Coefficient [280nm] 18115.00

References

Internal links
Protein Precursor Im16.1 precursor (5936)
Nucleic acids
Structure

External links

Tools