Co1.2 precursor (P06027) Protein Card

General Information
Name Co1.2 precursor
Organism Conus coronatus
Organism region Indo-Pacific
Organism diet vermivorous
Protein Type Precursor

Classification
Conopeptide class conotoxin
Gene superfamily A superfamily
Pharmacological family

Sequence
MGMRMMFTVFLLVVLATAVVS
STSDRASDGRNTASKVFDLI
ALTAR
EDCCFIDDCWASHPEACGGGMELLRQDPLNRDMPPS
A
Sequence region
[1-21]signal sequence
[47-83]mature peptideCo1.2

References

Internal links
Nucleic acids Conus coronatus A superfamily conotoxin Co1.2 precursor, mRNA, complete cds.
Structure

External links
Ncbi AGK23151

Tools