M23 precursor (P00605) Protein Card

General Information
Name M23 precursor
Organism Conus miliaris
Organism region Indo-Pacific
Organism diet vermivorous
Protein Type Precursor

Classification
Conopeptide class conotoxin
Gene superfamily O1 superfamily
Pharmacological family

Sequence
VLIIAVLFLTACQLTTA
VTSSRGKQKHRALRSTDKKFKVAL
L
CSPPGSYCFGPAACCSNFCSTMSDVCQENWSG
Sequence region
[1-17]signal sequence
[43-74]mature peptideM23

References
Duda,T.F. Jr. (0) Positive selection and patterns of divergence of orthologous toxin genes among related venomous predatory gastropods
Duda,T.F. Jr. and Remigio,E.A. (2008) Variation and evolution of toxin gene expression patterns of six closely related venomous marine snails. Mol. Ecol. 17:3018-3032

Internal links
Nucleic acids Conus miliaris isolate M23 four-loop conotoxin preproprotein mRNA, partial cds
Structure

External links
UniProtKB/Swiss-Prot A5X5Y5
Ncbi ABG26375

Tools