Tr7.5 precursor (P06087) Protein Card

General Information
Name Tr7.5 precursor
Organism Conus terebra
Protein Type Precursor

Classification
Conopeptide class conotoxin
Gene superfamily O3 superfamily
Pharmacological family

Sequence
MSGLGIMVLTLLLLVFMVTS
HQDSGEKRATRRNAINIGWRR
SIIRR
ASLDEECNEYCKQRTKNCCGKTNEEPVCARRCL
G
Sequence region
[1-20]signal sequence
[47-79]mature peptideTr7.5

References

Internal links
Nucleic acids Conus terebra O3 superfamily conotoxin Tr7.5 precursor, mRNA, complete cds.
Structure

External links
Ncbi AGK23211

Tools