S6.17 precursor (P06088) Protein Card

General Information
Name S6.17 precursor
Organism Conus striatus (Striated cone)
Organism region Indo-Pacific
Organism diet piscivorous
Protein Type Precursor

Classification
Conopeptide class conotoxin
Gene superfamily O3 superfamily
Pharmacological family

Sequence
MSGLGIMVLTLLLLVFMATS
RQDAGEKQATQRDAIKVIRR
S
VIQRKATEECEEVCEQDEKHCCDGSDGTPRCTSRCF
G
Sequence region
[1-20]signal sequence
[41-77]mature peptideS6.17

References

Internal links
Nucleic acids Conus striatus O3 superfamily conotoxin S6.17 precursor, mRNA, complete cds.
Structure

External links
Ncbi AGK23212

Tools