S6.18 precursor (P06090) Protein Card

General Information
Name S6.18 precursor
Organism Conus striatus (Striated cone)
Organism region Indo-Pacific
Organism diet piscivorous
Protein Type Precursor

Classification
Conopeptide class conotoxin
Gene superfamily O3 superfamily
Pharmacological family

Sequence
MSGLGIMVLTLLLLVIMA
TSHQDAGEKQMTQRDAINVRRRR
SITGRVVTEACEEACEQEEKNCCGITNGQPFCNFPCI
G
Sequence region
[1-18]signal sequence
[42-78]mature peptideS6.18

References

Internal links
Nucleic acids Conus striatus O3 superfamily conotoxin S6.18 precursor, mRNA, complete cds.
Structure

External links
Ncbi AGK23214

Tools