S8.2 precursor (P06092) Protein Card

General Information
Name S8.2 precursor
Organism Conus striatus (Striated cone)
Organism region Indo-Pacific
Organism diet piscivorous
Protein Type Precursor

Classification
Conopeptide class conotoxin
Gene superfamily S superfamily
Pharmacological family

Sequence
MMLKMGAMFVLLLLFTLASVQQ
EDVQARKTRLKRDFHRALR
QSPLGCPGTCGKGGKCVGSCECTMYKNCYCSNNGIRQPGCS
CTCPT
R
Sequence region
[1-22]signal sequence
[42-87]mature peptideS8.2

References

Internal links
Nucleic acids Conus striatus S superfamily conotoxin S8.2 precursor, mRNA, complete cds.
Structure

External links
Ncbi AGK23216

Tools