CnIK precursor (P06153) Protein Card

General Information
Name CnIK precursor
Alternative name(s) Cn10
Organism Conus consors
Organism region Indo-Pacific
Organism diet piscivorous
Protein Type Precursor

Classification
Conopeptide class conotoxin
Gene superfamily
Cysteine framework I
Pharmacological family

Sequence
QPLVVSFPSDSASDGRDDEAKDERSDIYESKR
NGRCCHPAC
GKYYSC
GR
Sequence region
[33-47]mature peptideCnIK

References

Internal links
Nucleic acids Conus consors partial mRNA for A superfamily propeptide Cn10 precursor, biomaterial CH070619AA-AC.
Structure

External links
Ncbi CCI55485

Tools