TxMMSK-06 precursor (P00616) Protein Card

General Information
Name TxMMSK-06 precursor
Organism Conus textile (Cloth-of-gold cone)
Organism region Indo-Pacific
Organism diet molluscivorous
Protein Type Precursor

Classification
Conopeptide class conotoxin
Gene superfamily M superfamily
Pharmacological family

Sequence
MMSKLGVLLTICLLLFPHTAVP
LDGDQHADQPAERLQDDIS
SEHHPMLNSIRRREQNQFMSFTSVKLRDSRGER
CCGPTACM
AGCRPCC
G
Sequence region
[1-22]signal sequence
[75-89]mature peptideTxMMSK-06

References
Conticello,S.G., Gilad,Y., Avidan,N., Ben-Asher,E., Levy,Z. and Fainzilber,M. (2001) Mechanisms for evolving hypervariability: the case of conopeptides Mol. Biol. Evol. 18:120-131

Internal links
Nucleic acids Conus textile TxMMSK-06 conotoxin scaffold III/IV precursor, mRNA, complete cds
Structure

External links
UniProtKB/Swiss-Prot Q9BPJ4
Ncbi AAG60357, Q9BPJ4

Tools