CnVIIJ precursor (P06160) Protein Card

General Information
Name CnVIIJ precursor
Organism Conus consors
Organism region Indo-Pacific
Organism diet piscivorous
Protein Type Precursor

Classification
Conopeptide class conotoxin
Gene superfamily O1 superfamily
Pharmacological family

Sequence
MKLTCVVIVAVLLLTACQLITA
DDSRGTQKHRSLRSTTKVS
K
STSCMKAGSYCRSTTRTCCGYCAYFGKFCIDFPSN
Sequence region
[1-22]signal sequence
[43-77]mature peptideCnVIIJ

References

Internal links
Nucleic acids Conus consors mRNA for O superfamily CnVIIJ precursor, biomaterial CH070619AA-AC.
Structure

External links
Ncbi CCI55500

Tools